<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6585 CA34872 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 6
2 D4T+DDI+RTV+SQV 17
3 ABC+EFV+NFV+NVP 41
4 3TC+APV+AZT+RTV 37
5 3TC+D4T+LPV+NVP 76

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   Y188L A98G K20KR, V35I, T39A, K43Q, E44D, V118I, K122E, I135T, V179VI, G196E, T200A, E203K, Q207E, H208Y, R211K, K223Q, V245E, A272P, T286A, I293V, E297KR S3A
>CA34872| codons 1-300
PIAPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLLVGSDLEIEQHRAKIKELREYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTREAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L33F, K43T, G73S, L89V L10V, T12DV, I13V, I15V, K20M, D60E, Q61D, I62V, L63P, C67Y, H69K, A71I, I72L, V77I  
>CA33857| codons 1-99
PQITLWQRPVVDVKVGGQLMEALLDTGADDTIFEEMNLPGRWTPKIVGGIGGFMKVRQYE
DVPIEIYGKKILSTVLIGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005