<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5735 CA34844 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 D4T 52
3 AZT+3TC 13
4 AZT+3TC+IDV 69
5 D4T+NFV+NVP 65
6 D4T+NVP+RTV 71
7 AZT+3TC+RTV+IDV 130

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T69DN, K70KR, M184V, T215F   K101E, Y181V   K20KR, T27S, E28K, K32E, V60I, R83K, V179I, T200A, Q207D, L228R, V245E, T286A, E297K  
>CA34844| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLSKEKIEALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSDRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
VQYVDDLYVGSDLEIGQHRAKIEELRDHLLRWGFFTPDKKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M   E35D, M36I, R41K, R57K, L63P, A71V, I72V, I93L  
>CA33837| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
QIPIEICGHKVVGTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012