<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1456 CA34842 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 30
2 AZT+DDC 43
3 3TC+D4T 31
4 3TC+AZT 13
5 3TC+AZT+SQV 22
6 3TC+AZT+IDV 65
7 3TC+AZT+NFV 9
8 3TC+AZT+NVP 44
9 D4T+IDV+RTV 42
10 ABC+APV+D4T+RTV+SQV 158

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N Y188L   P4PS, V35I, T39A, E44D, V60I, V118I, K122E, I135T, S162C, E203K, R211K, K223E, L228R, A272P, E312EK, G333E, Q334V, M357T, T369A, A371V, K390R, K395R, E399D, T403M, E413D, S468P, L491S, K512R, K558R  
>CA34842| codons 1-560
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIKELRQHLWKWGFYTPDNKHQEEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKKPVHGVYYDPSKDLIAEIQKQEVGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLAEVVQKIATESIVIWGKTPKFRLPIQRETWDAWWMEYWQATWIPDWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M G73T L10I, E35D, N37S, L63P, I64V, I66V, A71V, I93L  
>CA33835| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFLKVRQYD
QIPVEVCGHKVITTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005