<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
21012023 21012023 Nigeria 2011 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 FTC+NVP+TDF 148

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70E, M184V   Y181C, G190A V108I K20R, V35T, T39K, E40D, V60I, K101Q, L109I, D123E, T165I, F171Y, K173T, Q174R, I178M, T200A, Q207E, R211K, F214L, H221Y, L228R, V245Q, D250E, S251D, A272P, K277R, Q278H, K281R, T286A, E291D, V292I, I293V, E297A, L301M, I326V, Q334P, G335D K30R
>21012023| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEERIKALTEICKDMEKEGKISKIGPENPYNTPI
FAIKKKDSTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTIIDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPYRTRNPDMVI
CQYVDDLYVASDLEIGQHRAKIEELREHLLKWGLTTPDKKYQKEPPFRWMGYELHPDKWT
VQPIQLPEKEDWTVNDIQKLVGKLNWASQIYPGIKVRHLCRLLRGAKALTDIVPLTAEAE
MELAENREILKEPVHGVYYDPSKDLVAEIQKQGPD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, R41K, C67S, H69R, V82I, L89M  
>21012023| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEISGRKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016