<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
21012012 21012012 Nigeria 2011 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 FTC+NVP+TDF 114

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70EG, M184V, T215F   V106A, Y181C F227L T7TA, K20KR, V35T, S105T, L109I, D121H, K122E, I135V, S162A, K173T, Q174K, D177E, T200A, I202IV, Q207A, R211EK, H221Y, P225S, V245Q, T286A, E291D, V292I, I293V, P294T, E312D, S322T, I326V, G335D  
>21012012| codons 1-335
PISPIEAVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTGWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKTATVIDVGDAYFSVPL
HEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
CQYVDDLYVGSDLEIGQHRAKVEELRAHLLKWGFFTPDKKYQKESPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPTKDLVAEIQKQGQD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K20I, E35D, M36I, R41K, H69K, L89M  
>21012012| codons 1-99
PQITLWQRPLVTAKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016