<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14500 CA34831 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 280

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E     T39TA, V60I, A158S, T200TA, R211RK, F214L, R284K, D324E, I326V, K395R, E399G, L491S, K558R  
>CA34831| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKELVAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQRETWGAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37S, R41K, I62V, L63P, E65ED, I93L  
>CA33815| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QVPIDICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005