<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12012012 12012012 Thailand 2011 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 76

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184I K70KT L100I, Y181I V179D E6D, V35T, T39K, K43E, K103R, K122E, D123S, I135L, K173I, Q174K, D177E, I178V, T200TA, Q207A, R211S, V245E, A272P, V276I, T286A, E291D, V292I, I293V, E297A, L301IM, E312T, I329V, G335D  
>12012012| codons 1-335
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKNSTTWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKRKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEVDI
IQYIDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGAKALTDIVPLTAEAE
MELAENREILKTPVHGVYYDPSKDLIAEVQKQGQD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, R57RK, Q61QE, L63LP, H69K, L89M  
>12012012| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016