<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFKZB167 GFKZB167 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 148
2 EFV+FTC+TDF 55

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V V75VIM, T215I, K219E K103N, Y181C, G190A A98G, V108I V35T, E36A, T39E, E40D, K43KR, S48T, V60I, T69TN, S162C, K173A, Q174K, D177E, G196GE, T200A, I202IV, Q207E, R211K, F214FL, L228R, V245I, D250E, L283I, T286A, E291D, V292I, I293V  
>GFKZB167| codons 1-332
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEREGKITKIGPENPYNTPI
FAIKKKDSNRWRKLIDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIVI
CQYVDDLYVASDLEIEQHRAKVEELREHLLKWGLITPDEKHQKEPPFRWMGYELHPDKWT
VQPIILPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, P39Q, R41K, L63P, H69K, L89M, I93L  
>GFKZB167| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLQGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016