<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7072 CA34812 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 44
2 AZT+DDC+IDV 74
3 3TC+D4T+RTV+SQV 74
4 3TC+APV+D4T+EFV 94

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   L100I, K103N A98AG E6EK, K43KQ, E44ED, V118VI, K122E, D123E, I135V, I142IV, S162C, R211K, H221HY, V245E, A272P, K277R, E297K  
>CA34812| codons 1-301
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGIKKNKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M L33F, F53L L10LI, T12A, I13V, K14R, N37D, R41RK, L63P, I64V, G68GE, A71V, V77VI  
>CA33800| codons 1-99
PQITLWQRPIVAVRIGGQLKEALLDTGADDTIFEEMDLPGKWKPKIIGGIGGLIKVRQYD
QIPVEICEHKVIGTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009