<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFFSB019 GFFSB019 South Africa 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 94

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70E, M184V   V106M V179D, F227L V35T, T39D, S48ST, W88C, K103R, K122E, D123T, E138A, T139A, S162C, K173I, Q174K, T200A, Q207A, R211K, F214L  
>GFFSB019| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKITKIGPENPYNTPV
FAIKKKNSTEWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKRKSMTVLDVGDAYFSVPL
DETFRKYTAFTIPSINNAAPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPDIDI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGLTTPDKKHQKEPPLLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, K20R, E35D, M36I, N37D, R41K, Q61E, I62IV, L63P, H69K, K70R, T74A, V82I, L89M, I93L  
>GFFSB019| codons 9-99
PLVSIKVGGQTREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDEVPIEICG
KRAIGAVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016