<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFFSB010 GFFSB010 South Africa 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 80

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103S, V106M F227L V35M, E36A, T39E, K43R, S48T, K122E, D123S, I135L, K166R, K173T, Q174R, G196E, T200A, Q207E, R211K, F214L  
>GFFSB010| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMAICEEMEREGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKSKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTRNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELREHLLKWGLTTPDKKHQKEPPLLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19T, K20R, M36I, R41K, H69K, L89M, I93L  
>GFFSB010| codons 9-99
PLVTIKIGGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICG
KKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016