<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFGPB033 GFGPB033 South Africa 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 42

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115YF   V106M, Y181C V108I, F227L V35T, E36A, T39E, K46KQ, S48T, V60I, K101Q, K122E, D123S, K173A, D177E, Q197K, T200A, Q207A, R211K, H221Y, V245M, D250E, A272P, Q278H, K281R, T286A, V292I, I293V, Q334N, G335D, R356K, G359T, K366R, T377L, S379A, K390R, A400T, E404D  
>GFGPB033| codons 1-412
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGQITKIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSMTILDVGDAFFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
CQYMDDLYVGSDLEIGKHRAKIEELRAHLLKWGFTTPDKKYQKEPPLLWMGYELHPDKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKHLCRLLRGAKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLTEAVQKIALEAIVIWGKTPKFRLPIQKETWETWWTDYWQATWIP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19T, K20R, M36I, L63T, H69K, L89M, I93L  
>GFGPB033| codons 1-99
PQITLWQRPLVSIKIGGQTREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016