<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFKZB270 GFKZB270 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 117

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, L74V, Y115F, M184V   L100IM, K101E, V106M F227L V35T, E36A, T39E, S48T, V60I, I135V, K173A, Q174K, D177E, V179I, T200A, Q207N, R211K, V245Q, A272S, K277R, T286A, E291D, V292I, I293V, E308Q, V317A, D324E, I329L, Q334D, G335D, R356K, M357MR, G359T, T377L, K390R, A400L, E404N S68SDGN
>GFKZB270| codons 1-411
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKRKDDTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGMEKKKSMTVLDVGDAFFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIII
YQYVDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENRQILKEPVHGAYYDPSKELIAELQKQGDDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLTEAVQKIALESIVIWGKTPKFRLPIQKETWELWWTNYWQATWI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, E35D, M36I, R41K, K45R, D60E, L63P, H69K, L89M, I93L  
>GFKZB270| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016