<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4730 CA34788 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 13
2 3TC+D4T+NFV 65
3 D4T+DDI+NFV+NVP 144

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, L74LV, T215F   K103KN, Y181C V108VI K20R, V90VI, K122X, D123X, E169D, D177E, G196E, T200TA, E203K, R211S, H221HY, V245M, K277R, Q278H, I293V  
>CA34788| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DXXFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
CQYMDDLYVGSDLEIEQHRAKIKELRQHLLSWGFFTPDKKYQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGTKALTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   T12P, K14R, K20I, I62V, L63A, G68D, A71V, T74S, V77I, I93L  
>CA33773| codons 1-99
PQITLWQRPLVPIRIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVAIEICDHKVIGSVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005