<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2095 CA34779 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 AZT+ DDI 21
3 AZT+ DDC+ SQV 22
4 AZT+ DDC+ RTV 25
5 3TC+ AZT+ IDV 31
6 3TC+ AZT+ NVP 1
7 3TC+AZT+RTV+SQV 58
8 D4T+DDI+EFV+Unknown 34
9 APV+D4T+DDC+EFV+SQV 6
10 APV+D4T+DDI+EFV+NFV 65
11 APV+D4T+DDI+EFV+LPV 79
12 Unknown 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, D67N, Q151M, L210W, T215DY A62V, V75I, F77L, F116Y G190S   K43Q, W88S, K101Q, V118I, K122E, R172RK, I202V, E248ED, K281R, A288S, I293V, E297K  
>CA34779| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FVIKRKNSTKWRKLIDLRELNKRTQDFSEVQLGIPHPAGLQKKKSVTVLDVGDAYYSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPDIVI
YQYMDDLYVSSDLEIGQHRTKVEELRQHLWRWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKSLTEVVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A, L90M L33F, F53L K20R, E35D, M36I, N37S, R41K, D60E, I62V, L63P, A71V  
>CA33760| codons 14-99
KIGGQLREALLDTGADDTVFEDISLPGKWKPKIIGGVGGLVKVRQYEQVPIEICGHKVIG
TVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005