<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFECB047 GFECB047 South Africa 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 66

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V A62V, K70KT K103N, V106M F227L P4H, V35T, E36A, T39E, S48T, S68N, K122E, D123G, S162A, K173T, Q174K, G196E, T200A, Q207E, R211A, V245Q, K277KR, T286A, E291D, V292I, I293V, Q334N, G335D, R356K, G359T, T377R, S379SC, K390R, A400T, E404D  
>GFECB047| codons 1-432
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FVIKRKDNTTWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELREHLLAWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIARECIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, K20R, M36I, R41K, L63P, H69K, V77I, I93L  
>GFECB047| codons 1-99
PQITLWQRPLVTIKVGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016