<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5048 CA34759 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 110
2 D4T+IDV+NVP 24
3 None 70
4 D4T+DDI+LPV 49

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y188L   D121H, K122E, R172K, D177E, I178IM, L228LR, A272P, A288AS  
>CA34759| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPEMVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN N88D L10LI, K20R, E35D, M36I, R41K, K55KR, R57RK, L63P, A71T, V77I, I93IL  
>CA33747| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIRVKQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005