<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFKZB293 GFKZB293 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 356
2 EFV+FTC+TDF 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K103N, M230L V108I, F227L K20R, V35T, T39E, S48T, V60I, K122E, D123S, K173A, Q174K, D177E, T200A, Q207E, R211K, H221Y, V245E, E248D, D250E, A272P, K281R, L283I, R284RK, E291D, V292I, I293V, Q334N, G335D, R356K, G359T, T377M, S379C, K390R, A400T, E432D, V435E, A437V  
>GFKZB293| codons 1-440
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEELEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKYQKEPPLLWLGYELHPDKWT
VQPIELPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLIKGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMECIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIEGVETF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, T12S, I15V, L19V, E35D, M36I, R41K, Q61H, L63I, H69K, L89M, I93L  
>GFKZB293| codons 1-99
PQITLWQRPMVSIKVGGQVKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
HIIIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016