<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5155 CA34741 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 22
2 3TC+AZT+DDI 91
3 3TC+AZT 104
4 D4T+DDI+EFV 137

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV     V108I, V179D, P225PH V60I, K103R, I142V, A158S, I178M, F214L, H221Y, D237DE, V245KQ, A272S, K277R, I293IV, E297R  
>CA34741| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDMDI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKYQKEHPFLWMGYELHPEKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGTKALTEVVPLTREAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2QH, I13V, K20KR, L63P  
>CA33727| codons 1-99
PHITLWQRPLVTVKIGGQLREALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005