<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFNWB058 GFNWB058 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 EFV+FTC+TDF 54

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70E, Y115F, M184V   V106M V179D, F227L V35M, E36A, T39E, K122E, S162C, K173T, T200A, I202V, Q207K, R211A, P243T, V245Q, A272P, T286A, E291D, V292I, I293V, L310I, D320X E308~
>GFNWB058| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAFFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTQNPDIDI
YQYVDDLYVGSDLEIGQHRAKVEELRKHLLAWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENR~IIKEPVHGVYYXPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G17D, L19M, K20R, E35D, M36I, R41K, L63T, H69K, V82I, L89M, I93L  
>GFNWB058| codons 1-99
PQITLWQRPLVSIKVGDQMREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016