<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFMPB076 GFMPB076 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 52
2 3TC+EFV+TDF 59

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70E, L74LI, M184I   K103N P225H K22KR, V35T, E36A, T39E, S48T, E53D, W88CS, V90I, I135IMT, K173A, T200A, Q207E, H208HL, R211K, V245Q, K281KR, T286A, E291D, V292I, I293V  
>GFMPB076| codons 1-318
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTAICEEMEKEGKITKIGPDNPYNTPV
FAIKKKNSTEWRKIVDFRELNKRTQDFSEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPDIVI
YQYIDDLYVGSDLEIGQHRAKIEELRELLLKWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, L63P, H69K, I93L  
>GFMPB076| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016