<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFKZB354 GFKZB354 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 200
2 3TC+AZT+EFV 19

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R A62V V106M, M230L F227L V35T, E36A, T39D, S48T, E53D, K122E, D123N, S162C, K173A, Q174K, D177E, T200A, Q207A, R211K, L228H, V245Q, D250E, I257V, A272P, E291D, V292I, I293V, Q334D, G335D  
>GFKZB354| codons 1-345
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPDNPYNTPV
FVIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPLHWLGYELHPDKWT
VQPIQLPEKESWTVNDVQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGDDQWTYQIYQEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I3V, L10M, T12S, I15V, L19I, K20R, M36I, R41K, L63T, H69K, V77I, L89M, I93L  
>GFKZB354| codons 1-99
PQVTLWQRPMVSIKVGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016