<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFGPB037 GFGPB037 South Africa 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 38

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115YF   K101KE, V106M, Y181C F227L V35T, E36A, T39E, S48T, V60I, K122E, I135V, K173A, Q174R, D177E, T200E, Q207K, R211K, H221Y, V245Q, A272P, K277R, E291D, V292I, I293V, E297EK, V317T, D324E, Q334N, G335D, R356K, G359T L149LF
>GFGPB037| codons 1-371
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTVLDVGDAFFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVFPQGWKGSPAIFQSSMTKILEPFRARNPEIVI
CQYMDDLYVGSDLEIGQHREKIEELRKHLLKWGFTTPDKKYQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTKEAE
LELAENREILKEPVHGTYYDPSKELIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19V, K20R, M36I, R41K, Q61E, L63C, H69K, L89M, I93L  
>GFGPB037| codons 1-99
PQITLWQRPLVTIKIGGQVREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EICIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016