<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFECB084 GFECB084 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 620

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I D67DG, N348NIKM K103N   I31IL, V35T, E36A, T39E, S48T, V90I, A98S, K122E, D123S, T139TK, S162C, K173A, D177E, T200A, Q207E, V245Q, A272S, T286A, V292I, I293V, D324E, Q334H, G335D, R356K, M357KR, G359T  
>GFECB084| codons 1-368
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKGSTKWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAQNPEIVI
YQYIDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGHDQWTYQIYQEPFKILKTGKYAKRRTA
HTNDVKQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19IT, K20R, M36I, R41K, K43R, Q61N, L63T, H69K, T74S, L89M, I93L  
>GFECB084| codons 1-99
PQITLWQRPLVSIKIGGQTREALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
NITIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016