<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFKZB311 GFKZB311 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 196
2 3TC+EFV+TDF 43
3 EFV+FTC+TDF 60

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70E, M184V   V106M, G190A F227L V35T, T39D, S48T, V60I, K102Q, K122E, D123N, K173T, D177E, V189I, T200A, Q207N, R211K, H221HY, L228LR, V245Q, A272P, K277R, T286A, V292I, I293IV, D324E, G333GE, Q334D, G335GD, R356K, M357R, G359T, A360T, T377L  
>GFKZB311| codons 1-378
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKITKIGPENPYNTPI
FAIKKKNSTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYVDDLYIASDLEIGQHRAKIEELRNHLLKWGFTTPDKKYQKEPPLRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQEDDQWTYQIYQEPFKNLKTGKYAKRRTT
HTNDVKQLTEAVQKIALE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, R41K, H69K, L89M, I93L  
>GFKZB311| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016