<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GFNWB048 GFNWB048 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 178

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, M184V A62V, K70KQ V106M, G190A F227L K20R, V35T, T39E, S68KN, K122E, D123G, K173T, Q174K, N175NY, D177E, T200A, K201KR, Q207E, V245Q, D250E, A272P, K277R, T286A, E291D, V292I, I293V, V317A, Q334Y, G335D, R356K, G359A, T369A, T377M, K390R, E404D  
>GFNWB048| codons 1-409
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FVIKRKDNTQWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAFFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKYPEIVI
YQYVDDLYVASDLEIGQHRARIEELREHLLRWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGYDQWTYQIYQEPFKNLKTGKYAKMRAA
HTNDVKQLAEAVQKIAMESIVIWGKTPKFRLPIQKETWEAWWTDYWQAT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19T, K20R, M36I, R41K, Q61E, L63P, E65D, H69K, V77I, L89M, I93L  
>GFNWB048| codons 1-99
PQITLWQRPLVTIKVGGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EIPIDICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Steegen, K HIV-1 antiretroviral drug resistance patterns in patients failing NNRTI-based treatment: results from a national survey in South Africa. J Antimicrob Chemother, 2016