<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6418 CA34664 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 56
2 3TC+D4T+NFV 82
3 D4T+DDI+RTV+SQV 65
4 3TC+ABC+D4T 108

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V V75S, T215V, K219Q     K11KR, K64Y, K122E, N175Y, T200A, I202V, Q207E, L228H, A272P, I293V, S322T, Q334E, M357S, T369TA, K385KR, T386TI, K390R, K395R, A400T, K454R, D460N, R461K, S468T, H483Y, Q509L, K530KR Q547HN
>CA34664| codons 1-560
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIYKKNSTRWRKISDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQYPDIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLRWGFVTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARSRGA
HTNDVKQLAEAVQKIATESIVIWGRIPKFRLPIQRETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGRAGYVTNKGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQALPDKSESELVSQIIEQLIKKERVYLAWVPAHK
GIGGNENVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, L63P, V77VI  
>CA33645| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005