<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6583 CA34659 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT 9
3 3TC+AZT+SQV 22
4 3TC+AZT+IDV 104
5 AZT+RTV+SQV 30
6 3TC+ABC+EFV 65
7 APV+D4T+RTV 35
8 3TC+AZT+LPV+NVP 48
9 APV+EFV+IDV+TDF 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184MV, L210W, T215Y K219N K103N, Y181C V108VI K43N, A98S, V118VI, D177N, G196E, Q207H, H208HY, R211K, H221Y, A272S, T286A, E297K  
>CA34659| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTILDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
CQYVDDLYVGSDLEIEQHRTKIEELRHYLWKWGFYTPDNKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVIPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IL, L90M G73A L10I, K20KM, R41KT, L63P, A71T, I72R, V77I, I93L  
>CA33639| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFLKVRQYD
QIPIEICGHKTRATVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005