<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T8 T8 India 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 EFV+FTC+TDF 152

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, Y115F, M184V V75M V106M V179E, F227L V35T, T39D, E42D, E44D, S48T, E53D, V60I, S68N, W88C, D121H, K122E, I135T, I142V, S162A, K166KR, K173A, Q174QK, D177E, Q197L, T200A, Q207E, R211K K43HP, K46W
>T8| codons 21-239
VKQWPLTEEKIKALTEICDELDPDGWITKIGPDNPYNTPIFAIKRKDNTKWRKLMDFREL
NKRTQDFCEVQLGIPHPAGLKKKKSMTVLDVGDAFFSVPLHEDFRKYTAFTIPSTNNETP
GVRYQYNVLPQGWKGSPAIFQASMTRILEPFRAKNPEIEIYQYVDDLYVGSDLEIGLHRA
KIEELREHLLKWGFTTPDKKHQKEPPLLWMGYELHPDKW

References
Author Title Citation
Dinesha, TR Genotypic HIV-1 drug resistance among patients failing tenofovir-based first-line HAART in South India. ARHR, 2016