<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T120 T120 India 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 49

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   V106M, G190A F227L V35T, T39E, S48T, V60I, D121H, K122E, I135R, K173T, D177E, T200A, Q207A M16MR
>T120| codons 14-236
PGRDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPIFAIKKKDSTKWRK
LVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPLHEDFRKYTAFTIP
SRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVIYQYVDDLYVASDL
EIGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPLLWMGYELHP

References
Author Title Citation
Dinesha, TR Genotypic HIV-1 drug resistance among patients failing tenofovir-based first-line HAART in South India. ARHR, 2016