<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA478 CA34652 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 AZT+DDI 386
3 3TC+D4T+NVP 204

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M, M184V V75I, F77L, F116Y, K219KE K103KN, Y181YC K101N, V108VI V35IM, T39A, S68G, E79D, R83K, V90I, A158S, I202V, R211K, D218DE, H221HY, L228LR, V245E, R284K, T286A, E297A  
>CA34652| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIKRKDGTRWRKLIDLRDLNKKTQDFWEIQLGIPHPAGLNKNKSVTILDVGDAYYSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPSIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPEEKYQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVIPLTAEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, L63P  
>CA33636| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005