<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T34 T34 India 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 202

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, D67N, M184V K219E L100I, K101E, V106M E138K, F227L V35T, T39E, S48ST, V60I, S68ST, V90I, D121H, K122E, I135R, T165TI, K173T, Q174R, D177DE, V179VI, T200A, I202V, Q207E, R211K, D237E  
>T34| codons 13-238
KPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPIFAIKRKNTTKWR
KLVDFRELNKRTQDFWEIQLGIPHPAGIEKKKSMTVLDVGDAYFSVPLHEDFRKYTAFTI
PSRNNKTPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRTRNPEIIIYQYVDDLYVGSD
LEIGQHRAKVEELREHLLKWGFTTPDEKHQKEPPLLWMGYELHPEK

References
Author Title Citation
Dinesha, TR Genotypic HIV-1 drug resistance among patients failing tenofovir-based first-line HAART in South India. ARHR, 2016