<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T12 T12 India 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 EFV+FTC+TDF 92

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67G, V75M, K219E V106M, Y181C, M230L K101KN, F227L V35T, T39E, V60I, T69N, D121Y, K122E, I135T, I142V, S162A, K173T, D177E, T200A, R211T, F214L  
>T12| codons 13-235
KPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPIFAIKKKGSNRWR
KLMDFRELNKRTQDFWEVQLGIPHPAGLNKKKSMTVLDVGDAYFSVPLYEDFRKYTAFTI
PSTNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIVICQYVDDLYVGSD
LEIGQHRAKIEELRQHLLTWGLTTPDEKHQKEPPLLWLGYELH

References
Author Title Citation
Dinesha, TR Genotypic HIV-1 drug resistance among patients failing tenofovir-based first-line HAART in South India. ARHR, 2016