<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14385 CA34645 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 126
2 3TC+AZT 191
3 3TC+ABC+AZT 116

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74LI, M184V, L210LW, T215F D67T, K219E     V35M, K43X, T69N, I135IT, I167IV, G196E, I202IT, E203ED, K277R, R284K, I293V, M357T, A360V, A400T, F416Y, V458I, D460S, K512R, K527KQ  
>CA34645| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEXEGKISKIGPENPYNTPV
FAIKKKTSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKTDELRQHLWRWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGV
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEYVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYITSRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDRSESELVSQIIEQLIQKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q61QE, L63P, I72IV, V77I, I93L  
>CA33629| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EIPIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005