<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA378 CA34636 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 24
2 SQV 24
3 3TC+AZT+SQV 174
4 3TC+AZT+IDV 115
5 D4T+DDI+EFV 113

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210LW, T215Y D67DG K103N, Y181YC V108I K20R, S68SG, K102KR, V118VI, K122E, D123N, I135T, A158S, V189VI, T200TA, H221HY, V245E, Q278H  
>CA34636| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKGGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTILDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYIGSDLEIGQHRAKIEELRQHLWRWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVIPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, V82VA, L90LM   L10LI, R41RK, I62IV, L63P, A71AT, I93L  
>CA33620| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005