<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
11 11_POST South Africa 2014 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, E35D, M36I, R41K, R57K, D60E, H69K, L89M, I93L, T96P, N98D V75M
>11_POST| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QILIEICGKKAIGTMLVGPTPVNIIGRNMLTQLGCPLDF

References
Author Title Citation
Sutherland, KA Gag-protease sequence evolution following protease inhibitor monotherapy treatment failure in HIV-1 viruses circulating in East Africa. ARHR, 2015