<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
26 26 U.S. 2006 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54L, I84V, L90M L10F, L33F, K43T, G73T, L89V T4S, V11L, I13V, I15V, M36I, N37D, I62V, L63P, A71I, I72K, I85V K20A
>26| codons 1-99
PQISLWQRPFLTVKVGGQLAEALLDTGADDTIFEEIDLPGRWTPKIIGGIGGFLKVRQYD
QVPIEICGHKIKTTVLVGPTPVNVVGRNVMTQIGCTLNF

References
Author Title Citation
Margot, NA Phenotypic susceptibility to bevirimat in isolates from HIV-1-infected patients without prior exposure to bevirimat. AAC, 2010