<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14367 CA34615 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C   K49R, R83K, K102Q, D123E, I135IT, D177E, Q197E, R211K, H221HY, V245T, A272P, L283I, I329L, Q334E, R356K, K366R, T369TA, A376I, K390R, E399D, A400T, W410C, R448K, K454R, D460N, L491V, E516Q, S519N, E529D  
>CA34615| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGEHRTKIEELRQHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGEGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVRQLAEAVQKIITESIVIWGKTPKFRLPIQKETWDTWWTEYWQATCIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANKETKLGRAGYVTNRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGVEVNIVTDSQYALGIIQAQPDKSESQLVNQIIEQLIKKDKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15IV, E35D, N37P, L63P, I93L  
>CA33600| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMPLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009