<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5051 CA34602 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 236

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219KQ     K20R, T69S, E169D, G196E, Q197QK, R211RK, F214FL, S251T, K277R, E297K  
>CA34602| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEKHRTKIEELRQHLLKWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDTWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVIPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N Q58QE, N88D I13IV, K20R, E35D, M36X, N37E, I62IV, L63P, A71AV, I72IT, V77I, I93L  
>CA33587| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADNTVLEDXELPGRWKPKMIGGIGGFIKVREYD
QVPIEICGHKVTGTVLIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005