<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3888 CA34583 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 157

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70E, V75T       K11A, V35T, D86E, V106I, I135V, I142V, G196E, Q197K, Q207E, A272P, I293V, E297V, G333E, Q334H, M357I, A376T, T386I, V435E, D460N, R461K, L469I, L491S, L517I, S519N, Q520K, K527N, A534T  
>CA34583| codons 1-560
PISPIETVPVALKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTEWRKLTDFRELNKRTQEFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEKHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTVEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEHGQWTYQIYQEPFKNLKTGKYARIRGA
HTNDVKQLTEAVQKITTESIVIWGKIPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETKLGKAGYVTNKGRQKVVSITDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNKIIEQLINKEKVYLTWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   K20I, M36I, N37D, L63P, H69Y, K70R, A71V, V77I, I93L  
>CA33568| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYRVIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005