<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1459 CA34576 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI NA
2 AZT+ 3TC+ SQV 34
3 IDV+ AZT+ 3TC 17
4 NFV+ NVP+ D4T 21
5 NFV+ DLV+ D4T+ 3TC 21
6 3TC+D4T+DLV 16
7 3TC+AZT+RTV+SQV 14
8 SQV+ RTV+ EFV+ D4T+ 3TC 30
9 3TC+ DLV+ D4T+ APV+ ABC 60
10 3TC+ABC+APV+D4T+RTV 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, M184V, T215F D67G, K219Q K103N A98G K20R, T39A, V60I, S68G, T69E, K122E, D123N, I135T, D177E, I178M, V179VI, T200TA, F214FL, D218E, V245K, A272P, A288S, E297K  
>CA34576| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKGGERWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMII
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGLFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, I84V, L90M L33F, G73C L10I, L19I, I64V, A71V, V77I, C95L  
>CA33561| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTIFEEMNLPGRWKPKIVGGIGGFMKVRQYD
QILVEICGHKVICTVLIGPTPVNVIGRNLMTQIGLTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005