<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5015 CA34573 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 22
2 D4T 31
3 3TC+AZT 22
4 3TC+AZT+IDV 200
5 3TC+AZT+IDV+RTV 100

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K20R, T69S, K122E, I142V, V245KR, S251I, A272AP, Y339D, A371T, K390R, A400T, V467I, S468T, L469I, K558R  
>CA34573| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIRLPEKDIWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTDQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTETVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVITITDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54AV, V82T, L90LM   L10I, I13AV, K20I, E35D, M36I, N37D, R57K, L63P, I64IV, I66F, A71V, I72IL  
>CA33555| codons 1-99
PQITLWQRPIVTAKIGGQLIEALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFAKVKQYD
QIPVEFCGHKVLGTVLVGPTPTNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005