<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4159 CA34565 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 13
2 3TC+D4T+NFV 100
3 NVP+RTV+SQV 61
4 D4T+NVP+RTV+SQV 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F116Y K103N, Y181C   V35I, S68G, V90I, D121H, K122E, T139TA, K173Q, Q174R, D177E, I178L, G196E, T200A, R211T, F214L, V245M, E248D, D250A, A272P, E291D, I293V  
>CA34565| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
HEDFRKYTAFTIPSINNEAPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRQRNPELVI
CQYMDDLYVGSDLEIEQHRAKIEELRQHLLTWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKASWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M L10LF, V11I, F53L, Q58E, N88D I13V, L19I, K20I, E35N, M36I, N37DE, D60E, Q61E, L63P, A71V, I72T  
>CA33556| codons 1-99
PQITLWQRPFITVKIGGQIIEALLDTGADNTVLENIDLPGRWKPKMIGGIGGLVKVREYE
EIPIEICGHKVTGTVLVGPTPVNIIGRDLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005