<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6004 CA34563 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 170
2 3TC+AZT 13
3 3TC+AZT+IDV 137
4 D4T+EFV+IDV 110

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R   L100I, K103NS   E28A, I50V, A98S, K102R, K173R, G196E, L210LS, L228R, K277R, T286A, E297K  
>CA34563| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTEMEKEGKISKVGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGIKRNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLSRWGFTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, K14E, K55R, I62V, L63P, E65K, I66F, K70T, V77I  
>CA33534| codons 1-99
PQITLWQRPIVTIEIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIRVRQYD
QVPIKFCGHTAIGTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005