<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5212 CA34557 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 239
2 3TC+AZT 109
3 3TC+AZT+IDV 22
4 3TC+D4T+IDV 35
5 3TC+D4T+NFV 106
6 3TC+APV+D4T+NVP 20
7 3TC+APV+D4T+NVP+RTV 108

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V K219Q Y181C, G190GA V108I K20R, T39TA, V60I, V118VI, D121DH, K122X, D123E, I135IT, I142IL, K166R, D177DE, V179I, F214L, H221Y, L228H, A272P  
>CA34557| codons 1-285
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSIPL
HXEFRKYTAFTIPSTNNETPGLRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIII
CQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGLTTPDQKYQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84IV, L90M L10F, Q58QE I13V, K20I, E34EK, I54X, K55KR, D60E, Q61E, I62V, L63P, I93L  
>CA33544| codons 1-99
PQITLWQRPFVTVKIGGQLIEALLDTGADDTVLKEMNLPGRWKPKIIGGIGGFXRVREYE
EVPIEICGHKAIGTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005