<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14312 CA34519 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 169
2 3TC+D4T+NVP 96
3 ABC+NFV+SQV 159

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74LV, V75T, M184V K219Q K101KE, G190A   K20R, V35VI, V118I, S162D, V179I, F214L, D237DN, E248DN, A272P I37L
>CA34519| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIELCTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKVTDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIII
YQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGLTTPDQKHQKEPPFLWMGYELHPNKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, I13IV, E35D, M36I, D60E, Q61D, I62V, L63P, I66IV, H69Q, A71V  
>CA33503| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYE
DVPIEVCGQKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005