<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA643 CA34500 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 13
2 D4T 8
3 D4T+ 3TC 12
4 3TC+ D4T+ SQV 47
5 DDI+ AZT+ NFV 25
6 3TC+ D4T+ RTV+ SQV 31
7 AZT+ DDI+ NFV 61
8 ABC+ AZT+ DDI+ NFV 4
9 ABC+ AZT+ NFV 9
10 None 14
11 3TC+D4T+NVP 112

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A   K20R, K122E, D250E, A272P, P294Q E302D
>CA34500| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIQLTEEAE
LD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V  
>CA33475| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005