<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1165 CA34445 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDC 52
3 D4T 52
4 3TC+AZT+SQV 48
5 3TC+AZT+NFV 13
6 3TC+AZT+IDV+NVP 20
7 3TC+AZT+DLV+RTV+SQV 13
8 3TC+AZT 27
9 3TC+AZT+EFV+SQV 4
10 3TC+AZT+SQV 18
11 3TC+AZT 4
12 None 6
13 3TC+AZT+IDV+NVP+RTV 38
14 APV+D4T+DDI+Unknown 6
15 ABC+APV+D4T+RTV 27
16 3TC+ABC+D4T+LPV 95

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219R   A98G K20R, V60I, V118I, K122E, I135M, G196E, E203A, Q207E, H208Y, R211K, L228H, A288S, I293V, E297R  
>CA34445| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIAELREYLWKWGFYTPDRKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTREAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82A F53FL L10I, T12P, K14R, E35D, M36MI, N37D, L63P, C67D, A71AT  
>CA33431| codons 1-99
PQITLWQRPIVPIRIGGQLKEALLDTGADDTVLEDIDLPGRWKPKMIMGIGGLVKVRQYD
QIPIEIDGHKTIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005