<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5159 CA34426 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 191
2 AZT+DDI 17
3 3TC+AZT+SQV 22
4 3TC+AZT+IDV 104
5 3TC+AZT+NFV 26
6 3TC+AZT+NVP 167

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   Y181C   K32KR, K49KR, R83K, I135R, I178L, T200I, F214L, H221Y, V245KR, A272P, R284RK, I293V  
>CA34426| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
CQYVDDLYVGSDLEIGQHRIKIEELRQHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S  
>CA33412| codons 1-99
PQITLWQRPLVSIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009