<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5953 CA34415 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+IDV 13
2 AZT+D4T+IDV 61
3 ABC+DDI+EFV+IDV 22
4 None 74
5 ABC+DDI+EFV 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V T215D K103N, Y188L   I135V, T139M, S162C, D177E  
>CA34415| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNEMPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G17E, L19I, N37S, V77I  
>CA33400| codons 1-99
PQITLWQRPLVTIKIGEQIKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005